--- license: mit language: - en library_name: peft tags: - biology - protein language model - ESM-2 - post translational modification --- # ESM-2 QLoRA for Post Translational Modification ```python "eval_loss": 0.28556737303733826, "eval_accuracy": 0.9762591331328516, "eval_auc": 0.8833701456278934, "eval_f1": 0.1542571794425746, "eval_mcc": 0.25511446421928063, "eval_precision": 0.08547382057474782, "eval_recall": 0.7899691877651231, ``` ## Using the Model ```python from transformers import AutoModelForTokenClassification, AutoTokenizer from peft import PeftModel import torch # Path to the saved LoRA model model_path = "AmelieSchreiber/esm2_t12_35M_ptm_qlora_2100K" # ESM2 base model base_model_path = "facebook/esm2_t12_35M_UR50D" # Load the model base_model = AutoModelForTokenClassification.from_pretrained(base_model_path) loaded_model = PeftModel.from_pretrained(base_model, model_path) # Ensure the model is in evaluation mode loaded_model.eval() # Load the tokenizer loaded_tokenizer = AutoTokenizer.from_pretrained(base_model_path) # Protein sequence for inference protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence # Tokenize the sequence inputs = loaded_tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length') # Run the model with torch.no_grad(): logits = loaded_model(**inputs).logits # Get predictions tokens = loaded_tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens predictions = torch.argmax(logits, dim=2) # Define labels id2label = { 0: "No ptm site", 1: "ptm site" } # Print the predicted labels for each token for token, prediction in zip(tokens, predictions[0].numpy()): if token not in ['', '', '']: print((token, id2label[prediction])) ```